Protein Info for CA264_02050 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 36 to 38 (3 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 111 to 139 (29 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details amino acids 283 to 306 (24 residues), see Phobius details amino acids 328 to 350 (23 residues), see Phobius details amino acids 365 to 381 (17 residues), see Phobius details amino acids 388 to 406 (19 residues), see Phobius details amino acids 412 to 434 (23 residues), see Phobius details amino acids 449 to 470 (22 residues), see Phobius details PF00939: Na_sulph_symp" amino acids 4 to 468 (465 residues), 171.8 bits, see alignment E=2.9e-54 TIGR00785: transporter, divalent anion:Na+ symporter (DASS) family" amino acids 18 to 468 (451 residues), 265 bits, see alignment E=5.6e-83 PF03600: CitMHS" amino acids 33 to 405 (373 residues), 161.4 bits, see alignment E=3.2e-51 amino acids 294 to 467 (174 residues), 45 bits, see alignment E=8.2e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YN96 at UniProt or InterPro

Protein Sequence (471 amino acids)

>CA264_02050 anion transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MVVAPLLALLVWLLTPMLEHQARLVATIMAFCLVFWMAEVIPLSMTAFLGVLLAVMLGVA
EVETAFQNLGHPIILLFIGSFLLARSMTRHGLDKRIALFILSQPFFQQSLFRLFLGFSFI
SFVLSMWVSNSVTVAMLLPLMLGVTQLVCPPEQTGKSSAVYFLLGIAYSASIGGVSTIIG
SPPNLIGVNYLAQQGIRIDFLQWMYLALPVSLSMYGFLLLYMRYFLRKSDYNQQVVQAYV
EKHQQQREKLRKGEVVTMGVFTLAVVLWLAPGVFNLFGMEEAYAFMSAYFAESTVAVLAA
LLLFLIPPGQETGGAGTLIAEDLVKIDWDTILLFGGGMALGQLVVTSGLADVIGRSITSF
IDPNQQVLLVLVLVFLVLMLTEVSSNTAIAITFVPIIIGVLHGLGLPLLYPVLGAVLACS
MAFMLPVATPPNAIVYGSRQVPIGQMVRTGAILNLVATLLITAWMMLYMLV