Protein Info for CA264_02015 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: thiamine-phosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01379: thiamine-phosphate kinase
  • amino acids 11 to 341 (331 residues), 329 bits, E=1.3e-102
• PF00586: AIRS
  • amino acids 35 to 147 (113 residues), 105.8 bits, E=1.8e-34

Best Hits

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 61% identity to chu:CHU_2521)

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• thiamine diphosphate salvage I (1/2 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Sequence Analysis Tools

See A0A1X9YNB0 at UniProt or InterPro

Protein Sequence (341 amino acids)

>CA264_02015 thiamine-phosphate kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSEYTPLSEVGEFGLIRKIKEKIELRNESTVKGIGDDAAVLQPGEKQVVVSSDMLLESVH
FDLTFCPLKHLGYKAVAVNVSDIAAMNAKPTQITVNIAVGARFTLEAVEELYEGIRLACE
NYKVDLVGGDTTSSRAGLVISVTAIGEAAPEEIVYRNGAKVNDLVCVTGDLGAAYMGLQI
LEREKQAFLANPDMQPELEEKQYIVGRQLRPEARMDVIYDLKERGVQPTSMIDISDGLAS
ELFHICSQSKVGAVVYKDNLPADPQMLETAVEFNIDPLTCIMNGGEDYELLFTVPLSAYD
ELKNHPDITIIGNITQEGEGVNLATKSGQVFPLKAQGWSHF