Protein Info for CA264_01835 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF00583: Acetyltransf_1" amino acids 32 to 129 (98 residues), 28.2 bits, see alignment E=4.1e-10 PF13673: Acetyltransf_10" amino acids 46 to 148 (103 residues), 51.3 bits, see alignment E=2.3e-17 PF13508: Acetyltransf_7" amino acids 48 to 130 (83 residues), 27.1 bits, see alignment E=9.2e-10

Best Hits

Swiss-Prot: 40% identical to Y451_SYNY3: UPF0039 protein sll0451 (sll0451) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02348, ElaA protein (inferred from 66% identity to shg:Sph21_1206)

Predicted SEED Role

"ElaA protein" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YN21 at UniProt or InterPro

Protein Sequence (149 amino acids)

>CA264_01835 GNAT family N-acetyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MEPTFICKPFAELTPFELYDMLRLRSDVFVVEQTCVFLDMDNKDQKCQHLLLYRGSELVA
TSRLVPPGLSYPDAMSIGRIVSSRAVRGTGVGKVLVERSIEACYRLYGNGPIKIGAQLYA
KGFYESFGFVQSGPVYDEDGIDHIEMTKA