Protein Info for CA264_01830 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: Bcr/CflA family drug resistance efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 6 to 385 (380 residues), 332.1 bits, see alignment E=3.2e-103 PF07690: MFS_1" amino acids 16 to 355 (340 residues), 164.7 bits, see alignment E=4.3e-52 PF00083: Sugar_tr" amino acids 38 to 185 (148 residues), 42.7 bits, see alignment E=5.5e-15

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 70% identity to sli:Slin_3348)

Predicted SEED Role

"Multidrug resistance transporter, Bcr/CflA family" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YN44 at UniProt or InterPro

Protein Sequence (416 amino acids)

>CA264_01830 Bcr/CflA family drug resistance efflux transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MTKREYFIIILILGALATISPFSIDMYLPGFPAISKDLNATIAQVQLSLTAYLVGISVGQ
LLYGPLLDRFGRKNPLYAGLLIYIAASLACAYTDSVNSLIMMRFIQAVGGCAGMVAAQAL
VRDIFPVNKTAQAFSLLTLVIAVSPMIAPTVGGYVTAAFGWHAVFIILAAITALIMVGVY
VALPEGQQPDQSISLKPKPVIKNFLSVLKQEQFLLYALAGGIATAAPFAYIAGSSDVFMN
IYHVSEKEYGWIFAFLAFAMIGSTQLNHFILNKYKSEQVINFTLIYQTVVAVLLVVGSYY
GWYGKYSLIALLFIFLTGQGLLNPNATALSLAPFTKNTGSAAALLGSFRMAMGGLMSAAV
SIFHTGTTLPMVSVMAGCAVTGLVLLLLGKRTIRHRASRRAVEDDTSVLVSTRMEH