Protein Info for CA264_01750 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 61 to 79 (19 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 11 to 295 (285 residues), 170.5 bits, see alignment E=4.4e-54 PF03812: KdgT" amino acids 37 to 156 (120 residues), 25.8 bits, see alignment E=7.1e-10

Best Hits

Swiss-Prot: 48% identical to Y1437_BDEBA: UPF0324 membrane protein Bd1437 (Bd1437) from Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100)

KEGG orthology group: None (inferred from 52% identity to fjo:Fjoh_2884)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YN13 at UniProt or InterPro

Protein Sequence (315 amino acids)

>CA264_01750 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MPLTKNRPSLLLQKAAFILAAILILFSPWFSSPEALALGLFVGLVLGNPFQEWSDAASKY
VLQAAVVGLGFGIDLYQVAETGLRGLLYTAVSLTVTMALGFLLGKLLHTAPKLTHLISSG
TAICGGSAIAAVAPAIKASAQEISVSLGVVFILNAVALFVFPAVGHALGMTQQQFGTWAA
IAIHDTSSVVGAASKYGPEALQLATTLKLTRALWIVPLVLVSGMAFKAGGAKVSVPLFIL
LFVLASVLVTFVPAVPAIAPPILFAAKKGLLLSLFLIGANLNRNTLRSISARPFYHGVIL
WVLVAAGSLGAIVLL