Protein Info for CA264_01740 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: proton-translocating NADH-quinone oxidoreductase subunit N

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 transmembrane" amino acids 14 to 38 (25 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 216 to 240 (25 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 286 to 307 (22 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 425 to 445 (21 residues), see Phobius details amino acids 468 to 486 (19 residues), see Phobius details TIGR01770: proton-translocating NADH-quinone oxidoreductase, chain N" amino acids 22 to 489 (468 residues), 351.3 bits, see alignment E=5e-109 PF00361: Proton_antipo_M" amino acids 138 to 425 (288 residues), 212.9 bits, see alignment E=3.1e-67

Best Hits

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain N (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMZ5 at UniProt or InterPro

Protein Sequence (501 amino acids)

>CA264_01740 proton-translocating NADH-quinone oxidoreductase subunit N (Pontibacter actiniarum KMM 6156, DSM 19842)
MNEQAVYLADQLNAIIAGAGTLLPEFLLAFFFLLLVTLDLFKSKAIKRLLPWLALTGLFS
GLLLQVLGGYAGVEEPFLNLLVSDGVARYGGILFSAAGIFTVFMALQHRGLEKLEEGRGE
FYALLLVLVLGLNLMAKSVNLLMVFLAIETVSIASYILTLTFKQEKRAVEAGLKYVLYGA
LSAGVMLYGMSFFYGLTGTLNYTSDVFALSLMQADGLLVTVATVLVLAGFFFKISAVPFH
FWAPDVYQGAPLPVVALFSTAPKMAGILVILRFVTNFADATTFADVQLLLGIAAIATLVI
GNFTALWQKTPRRLLAYSSVSHAGFLLMALLAFGSSYTSAVLFYLTVLLFMNFGIFLVLQ
VAEERFGVKTLEDFSGLGRLQPYLGVMAVLYLLSLTGLPPLGGFMGKLLVFSNVWEAYTL
SGNTLLLVLLITGILLTGVALFYYIKIPYYLFFKRNQTQENLVISPSNKLLLALFSLPLL
VLFFKPDLLLRWIEQLLAHTL