Protein Info for CA264_01735 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 147 to 164 (18 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details amino acids 395 to 417 (23 residues), see Phobius details amino acids 437 to 465 (29 residues), see Phobius details amino acids 480 to 499 (20 residues), see Phobius details amino acids 529 to 549 (21 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 140 to 196 (57 residues), 41.4 bits, see alignment 5.4e-15 amino acids 270 to 474 (205 residues), 198.6 bits, see alignment E=6.8e-63 TIGR01972: proton-translocating NADH-quinone oxidoreductase, chain M" amino acids 271 to 558 (288 residues), 346.5 bits, see alignment E=1.2e-107

Best Hits

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain M (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YN14 at UniProt or InterPro

Protein Sequence (580 amino acids)

>CA264_01735 oxidoreductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNFILSSLIFTPLLAALIVLLLPARLQKPVKAVALVGALVQMGLSILLYFRFDGSTVANG
QQGYQFVEKVNWIGFALGSLGRFQIDYFVGVDGVSISMVLLTGIVGVIGVISSWAITKNV
KGYFLLYLLLLTSVMGCFLALDFFLFYLFFEFMLLPMYFLIGIWGGPKREYAAIKFFIYT
LVGSLFILLVMIGLYTSVIDPAATAAQMGLLDQGTAVGADVLKQVQQMLQRSQISNYNLV
HTFSIPAMMEPANFIPGSLLHVLSGAMLWDLPLRFIAFLLLFAGFAIKVPSVPVHTWLPD
AHVEAPTPISVLLAAVLLKVGGYGLIRIVYPVFPDAGAYFAVLVGGLGVLSIIYGALNAL
AMNDLKKLIAYSSVSHMGFVLLGLASLTIEGVNGAIYMMFSHGIISAMLFLVVGVIYDRA
HDRMIQNFRGLASVMPAYTAFVVIAFFASLGLPGFSGFIAELLVLVGGFGAPEATGLLPR
WLTVVAVFGLLLAAAYYLWALQRMFFGKYWIFPELRAEAVMTDLNKREYLMLVPLAVLAL
LFGIFPHLLLDKISLTVTGFTELLLQRGQEQLGLIFSRLQ