Protein Info for CA264_01725 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NADH-quinone oxidoreductase subunit K

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00420: Oxidored_q2
  • amino acids 9 to 98 (90 residues), 85.7 bits, E=7.4e-29

Best Hits

Swiss-Prot: 51% identical to NUOK_CHLP8: NADH-quinone oxidoreductase subunit K (nuoK) from Chlorobaculum parvum (strain NCIB 8327)

KEGG orthology group: K00340, NADH dehydrogenase I subunit K [EC: 1.6.5.3] (inferred from 65% identity to sli:Slin_4911)

MetaCyc: 54% identical to ferredoxin-plastoquinone oxidoreductase subunit E (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain K (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (2/6 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See A0A1X9YMZ4 at UniProt or InterPro

Protein Sequence (104 amino acids)

>CA264_01725 NADH-quinone oxidoreductase subunit K (Pontibacter actiniarum KMM 6156, DSM 19842)
MEAVPLEHILLLGAVLFSLGILAVISKRHAVVVLMGIELIFNAANLNLVAFSRYDPSLLQ
GQMFSLFVIVVAAAEAAVALAIVLRVYQYFKTANLNEIVSPENK