Protein Info for CA264_01720 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NADH-ubiquinone/plastoquinone oxidoreductase chain 6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 30 to 51 (22 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details PF00499: Oxidored_q3" amino acids 18 to 168 (151 residues), 117 bits, see alignment E=2.9e-38

Best Hits

KEGG orthology group: K00339, NADH dehydrogenase I subunit J [EC: 1.6.5.3] (inferred from 41% identity to psn:Pedsa_1947)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YN30 at UniProt or InterPro

Protein Sequence (175 amino acids)

>CA264_01720 NADH-ubiquinone/plastoquinone oxidoreductase chain 6 (Pontibacter actiniarum KMM 6156, DSM 19842)
MDNINMLFYIFAILAILSAAYMVLTRNLLYAGFSLLITLLSLAGIYVLLFADFVAVTQLM
VYVGGVLVLILFGIMLSSRVQDKSVLSESVNKVWGTTVAGLILVGMCYTILKSNISALPW
LQTTEVNVLGLQKSTVQSIGIKLMTDVVVPFELASLLLLIALIGAAYIATDNQKA