Protein Info for CA264_01685 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glutamate racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K01776, glutamate racemase [EC: 5.1.1.3] (inferred from 70% identity to dfe:Dfer_3460)

Predicted SEED Role

"Glutamate racemase (EC 5.1.1.3)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Peptidoglycan Biosynthesis (EC 5.1.1.3)

MetaCyc Pathways

peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YN11 at UniProt or InterPro

Protein Sequence (271 amino acids)

>CA264_01685 glutamate racemase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTQEKKDRPIGVFDSGIGGLTVAQAIINVLPNERIVYFGDTAHLPYGDKSTAAIQAYAVK
ICDLLIRQNCKVILIACNSASAAAYELVKEYVGSKAKVLNVIDPTVHYIGQAYAQKTVGL
IGTKQTVNSNVYRKKVDELDRGVELRSLATPLLAAMIEEGFFNDSISESVIHTYLSDPQL
RHIEALILGCTHYPLIKKQIEGYYEGKVDVLDASQIVAQYVKAYLEEHNLAADKPSGDHT
FYVSDFTRSFEESTRIFFKRKVNLEHYPLWE