Protein Info for CA264_01670 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 PF00005: ABC_tran" amino acids 20 to 181 (162 residues), 107.2 bits, see alignment E=8e-34 amino acids 330 to 464 (135 residues), 81.8 bits, see alignment E=5.5e-26 PF12848: ABC_tran_Xtn" amino acids 221 to 295 (75 residues), 54.5 bits, see alignment E=7.3e-18 PF16326: ABC_tran_CTD" amino acids 556 to 623 (68 residues), 58.5 bits, see alignment E=4.4e-19

Best Hits

Swiss-Prot: 46% identical to YFMR_BACSU: Uncharacterized ABC transporter ATP-binding protein YfmR (yfmR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 61% identity to dfe:Dfer_4068)

Predicted SEED Role

"COG0488: ATPase components of ABC transporters with duplicated ATPase domains" in subsystem Folate Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YN20 at UniProt or InterPro

Protein Sequence (625 amino acids)

>CA264_01670 ABC transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MNYLSAENISKSFGDRWLFKNLNFGISQGQRVVLVGVNGSGKTTLLNVLAGKLPPDEGSV
SVRKEVRIGYLGQNPEFDEELTVQQTIFSMQNETLELIKAYEAAIANPNTSAEKMQQLME
RMDELQAWDFEVKVKQVLSKLGINNLDVQIKKLSGGQRKRVAMARVLIEEPEMLILDEPT
NHLDLDTIEWLEGMLSTQNTTLLMVTHDRYFLDKVANEIAELDNGEIYTYKGNYSYFLEK
KAEREMSAAAETEKARNLMRKELEWIRRMPKARGTKAKYRVDAFEDLKEKAAKKTSGPQL
ELSVKTTRQGGKIIEVDHISKSFGEKKIVDDFSYIFKKKDRIGIVGPNGAGKSTFLNMLT
GKLQPDAGTIEAGQTTVFGYYTQDELVYKEDQRVIDIVKEIAEVVEMANGEVITASQFLQ
HFQFAPPQQYTFVSKLSGGEKRRLQLLRVLIKNPNFLILDEPTNDLDIITLNILEDFLLN
FGGCLIIVSHDRYFMDRLVEHLFVFEGEGRIRNFPGNYTDYREWQKEQEKLQQEEAKAAP
APVVEKKQEQPNAKRKATFNEKKEYERLEQEIEQMETRKSEIIETMNSNTLTDHEELTAL
AKELERINEQLEEKEFRWLELAELM