Protein Info for CA264_01650 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: YebC/PmpR family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 1 to 241 (241 residues), 312.2 bits, see alignment E=1.3e-97 PF20772: TACO1_YebC_N" amino acids 5 to 75 (71 residues), 114 bits, see alignment E=3.6e-37 PF01709: Transcrip_reg" amino acids 81 to 240 (160 residues), 191.7 bits, see alignment E=7.6e-61

Best Hits

Swiss-Prot: 52% identical to Y1318_RUBXD: Probable transcriptional regulatory protein Rxyl_1318 (Rxyl_1318) from Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)

KEGG orthology group: None (inferred from 54% identity to zpr:ZPR_0003)

Predicted SEED Role

"FIG000859: hypothetical protein YebC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMZ3 at UniProt or InterPro

Protein Sequence (251 amino acids)

>CA264_01650 YebC/PmpR family DNA-binding transcriptional regulator (Pontibacter actiniarum KMM 6156, DSM 19842)
MAGHNKWSQIKRKKGALDAKRSKIFTKLIKEITVAVKEGGADPDANPRLRLAIQMSKGAN
MPKDNIERAVSKGEGGDASDYSQVNYEGYGPGGVAVYVECLTDNINRTVQNLRTMFNKSG
GSLGTSGSVEYLFDRKGVFVAHRNPEQPIDEDELLLELADGGAEEVEFEEGYMTIYSAME
DFGALQKKVEELNLDLESADLQRLPQTTVKVEDPEAVRKVLRLIDSLEDDDDVQQVYHNL
ELSEEVMAALE