Protein Info for CA264_01615 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glutathione peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00255: GSHPx
  • amino acids 16 to 121 (106 residues), 125 bits, E=1e-40

Best Hits

Swiss-Prot: 46% identical to GPX1_SYNY3: Hydroperoxy fatty acid reductase gpx1 (gpx1) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 60% identity to mtt:Ftrac_3240)

MetaCyc: 46% identical to hydroperoxy fatty acid reductase 1 (Synechocystis sp. PCC 6803)
RXN-13944 [EC: 1.11.1.22]; 1.11.1.- [EC: 1.11.1.22]

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• glutathione-peroxide redox reactions (2/3 steps found)

KEGG Metabolic Maps

• Arachidonic acid metabolism
• Glutathione metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.9

Use Curated BLAST to search for 1.11.1.22 or 1.11.1.9

Sequence Analysis Tools

See A0A1X9YXL8 at UniProt or InterPro

Protein Sequence (167 amino acids)

>CA264_01615 glutathione peroxidase (Pontibacter actiniarum KMM 6156, DSM 19842)
MATETTSTPNSQTSDFYGFKMKSLDGKEVDFSQYKGKKVLLVNTASECGYTPQYKDLQQL
HETHGSDVAILGFPANNFGGQEPGSNEQIASFCQKNYGVSFPMFEKVSVVGDDKHPLFVW
LAQNAPNHEEPNWNFCKYLVNENGQVQAFYPSKVKPMDEELLSAIKQ