Protein Info for CA264_01580 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: D,D-heptose 1,7-bisphosphate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR01662: HAD hydrolase, family IIIA" amino acids 5 to 145 (141 residues), 106 bits, see alignment E=1.8e-34 TIGR01656: histidinol-phosphate phosphatase domain" amino acids 5 to 144 (140 residues), 105.9 bits, see alignment E=1.7e-34 PF08645: PNK3P" amino acids 12 to 131 (120 residues), 34.9 bits, see alignment E=2.5e-12 PF00702: Hydrolase" amino acids 14 to 139 (126 residues), 48.4 bits, see alignment E=3.2e-16 PF13242: Hydrolase_like" amino acids 100 to 146 (47 residues), 50.3 bits, see alignment E=3.8e-17 PF13419: HAD_2" amino acids 101 to 145 (45 residues), 39 bits, see alignment E=2e-13

Best Hits

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 63% identity to mtt:Ftrac_3745)

Predicted SEED Role

"D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 3.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-, 3.1.3.-

Use Curated BLAST to search for 3.1.1.- or 3.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMX4 at UniProt or InterPro

Protein Sequence (173 amino acids)

>CA264_01580 D,D-heptose 1,7-bisphosphate phosphatase (Pontibacter actiniarum KMM 6156, DSM 19842)
MQKQKCIFLDRDGVLNRERGDYTYKLDDFEVLPRVPEALRLLKKNGYLLIVVTNQAGIAK
GLYKKDDVLACHGKLQDACSSLLDAIYFAPNHPNFSASLARKPDSLMLEKAMAKYNIDPA
ASWMVGDSVRDIEAAAKVGVRSVLVGDKYGPGTHTNQVQDLWEATQLILAQNT