Protein Info for CA264_01570 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: dolichyl-phosphate beta-D-mannosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 49% identical to PPM1_MYCS2: Polyprenol monophosphomannose synthase (ppm1) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K00721, dolichol-phosphate mannosyltransferase [EC: 2.4.1.83] (inferred from 71% identity to dfe:Dfer_3842)

Predicted SEED Role

"Dolichol-phosphate mannosyltransferase"

MetaCyc Pathways

protein O-mannosylation II (mammals, core M1 and core M2) (1/5 steps found)
protein O-mannosylation III (mammals, core M3) (1/5 steps found)
protein O-mannosylation I (yeast) (1/8 steps found)
protein N-glycosylation (Haloferax volcanii) (1/11 steps found)
protein N-glycosylation initial phase (eukaryotic) (1/19 steps found)

KEGG Metabolic Maps

N-Glycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YN32 at UniProt or InterPro

Protein Sequence (244 amino acids)

>CA264_01570 dolichyl-phosphate beta-D-mannosyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKDSLVIIPTYNERENIEAMVRRVMTLSHPFDLLIVDDGSPDGTADIVRQLQQEFPNRLH
LEVRKGKLGLGTAYIHGFKYALRHGYEYIFEMDADFSHNPADLVRLYHACATDGYDVAIG
SRYVQGVNVVNWPMSRVLMSYFASSYVRVVTGMPIHDTTAGFKCYRRKVLETIQLNRIRF
VGYAFQIEMKFLAYKYGFKIKEVPIIFTDRTKGTSKMSTGIFKEAVMGVLQMKVSSYFRH
FDRY