Protein Info for CA264_01565 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: tellurium resistance protein TerC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 191 to 218 (28 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details TIGR03718: integral membrane protein, TerC family" amino acids 4 to 303 (300 residues), 415.2 bits, see alignment E=8.8e-129 PF03741: TerC" amino acids 68 to 272 (205 residues), 177.7 bits, see alignment E=9.5e-57

Best Hits

Swiss-Prot: 50% identical to Y319_MYXXA: Uncharacterized membrane protein STKORF319 from Myxococcus xanthus

KEGG orthology group: K05794, tellurite resistance protein TerC (inferred from 59% identity to chu:CHU_1367)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMW5 at UniProt or InterPro

Protein Sequence (313 amino acids)

>CA264_01565 tellurium resistance protein TerC (Pontibacter actiniarum KMM 6156, DSM 19842)
MDEIFFWIIFNAFVLLLLGLDLFVFHRKEHEVKIKEALLWSLFWIVLSLCFNALIYFWEG
PAAALEFLTGYLIEKSLSVDNLFVFIMIFNFFKVPLKFQHKILFWGIIGALVLRAIFILV
GVALIAKFHFIIYILGAFLVFTGIKMAFSHGGDEVHPENNPLVNWVSRHIRVTKQPVGGK
FFTKIDGKWFATPLFLVLVMVESTDVVFAADSIPAILAISKDPFIVYTSNVFALLGLRAL
YFALAGIMQLFHYLHYGLSVILVFIGAKLLLSDIVEVDMRYALLVVGAILAVSVIASLLF
PKKEELPKPPTEE