Protein Info for CA264_01555 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00800: PDT
  • amino acids 6 to 184 (179 residues), 182.1 bits, E=4.6e-58

Best Hits

KEGG orthology group: K04518, prephenate dehydratase [EC: 4.2.1.51] (inferred from 40% identity to pru:PRU_1174)

Predicted SEED Role

"Prephenate dehydratase (EC 4.2.1.51)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 4.2.1.51)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (17/18 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• L-phenylalanine biosynthesis I (3/3 steps found)
• L-phenylalanine biosynthesis III (cytosolic, plants) (2/2 steps found)
• superpathway of chorismate metabolism (39/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.51

Sequence Analysis Tools

See A0A1X9YMW3 at UniProt or InterPro

Protein Sequence (288 amino acids)

>CA264_01555 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MNRTRIAIQGGPASFHDAAARQLHPAQQVDTVPCTSFRSLCTTLANSEADAAMMAIENTL
AGSLLPNYTLLQEFRLLATAELWLPIDQNLLALPGQRLEDVHSVISHPVALAQCSSFLQR
HPHLQAQPSHDTADSAKAIREGQLKGTAAIAGKAAAALYGLEVLQANIADSPTNYTRFLF
LQRAQPEAPATANKAIVVCRKPLRTATLTLLLSQLQKHQVELKLLQTLPSGNQQPYLVAE
LEAAGKEQLQEAVTHIRPLVEDLHLLGLLQKAALPTPTAREPQEAATV