Protein Info for CA264_01540 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 70 to 87 (18 residues), see Phobius details PF12823: DUF3817" amino acids 6 to 91 (86 residues), 94.6 bits, see alignment E=2.6e-31 TIGR03954: integral membrane protein" amino acids 9 to 91 (83 residues), 101.9 bits, see alignment E=1.3e-33

Best Hits

Swiss-Prot: 49% identical to YDZA_BACSU: Uncharacterized membrane protein YdzA (ydzA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 56% identity to bbe:BBR47_12090)

Predicted SEED Role

"FIG00968898: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMY0 at UniProt or InterPro

Protein Sequence (107 amino acids)

>CA264_01540 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MNTPISRLRLVGTLEGISYLLLLGIAMPLKYMFDMPAMVKYTGWAHGLLFVLYILALLHV
TLAHNWGFKKLAAGFVASLLPFGPFIFDKKILDQEEPKTQERQKQVA