Protein Info for CA264_01430 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: transcriptional repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF01475: FUR" amino acids 22 to 141 (120 residues), 101.5 bits, see alignment E=1.8e-33

Best Hits

Swiss-Prot: 36% identical to FUR_CAMJ8: Ferric uptake regulation protein (fur) from Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)

KEGG orthology group: K03711, Fur family transcriptional regulator, ferric uptake regulator (inferred from 84% identity to mtt:Ftrac_1135)

Predicted SEED Role

"Ferric uptake regulation protein FUR" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Iron acquisition in Vibrio or Oxidative stress or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMX7 at UniProt or InterPro

Protein Sequence (164 amino acids)

>CA264_01430 transcriptional repressor (Pontibacter actiniarum KMM 6156, DSM 19842)
MALDHIKFEEVKKIFTAYLESKGLRKTPERYAILEEIYSRDGHFDVESLYISMKNKNYRV
SRATVYNTLDLLVENDLVSKHQFGRNLAQYEKSYGYRQHDHVICTECHKVVEFCDPRIHN
IQTMVGELLNFHILHHSLNLYGVCGDCRAKKATEEPKHEVSDRT