Protein Info for CA264_01410 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ATP-dependent Clp protease proteolytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 126 to 144 (19 residues), see Phobius details PF00574: CLP_protease" amino acids 54 to 230 (177 residues), 269.7 bits, see alignment E=6.6e-85

Best Hits

Swiss-Prot: 74% identical to CLPP_BACFR: ATP-dependent Clp protease proteolytic subunit (clpP) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K01358, ATP-dependent Clp protease, protease subunit [EC: 3.4.21.92] (inferred from 76% identity to sli:Slin_1143)

MetaCyc: 59% identical to ClpP2 (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent or cAMP signaling in bacteria (EC 3.4.21.92)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMU3 at UniProt or InterPro

Protein Sequence (233 amino acids)

>CA264_01410 ATP-dependent Clp protease proteolytic subunit (Pontibacter actiniarum KMM 6156, DSM 19842)
MMFNKDEFRKFAVKGQGMSSLGVDQYIHHVEGRAMHNIESMTRSVIEERPTNFREIDVFS
RLIMDRIIFLGTQVDDFIANIITAQLLFLESADAKKDILLYINSPGGSVYAGLGIYDTMQ
YVSPDVATICTGLAASMGAVLLAGGAKNKRSALPHARIMIHQPMGGAQGQASDIEITARE
ILKLKKELYEILADHSGKSYQEVYDNSDRDYWMRAEEAKEYGLIDEVLTRKTS