Protein Info for CA264_01405 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ATP-dependent Clp protease ATP-binding subunit ClpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 TIGR00382: ATP-dependent Clp protease, ATP-binding subunit ClpX" amino acids 4 to 394 (391 residues), 565.3 bits, see alignment E=4.3e-174 PF06689: zf-C4_ClpX" amino acids 5 to 41 (37 residues), 52.8 bits, see alignment 1.2e-17 PF00493: MCM" amino acids 64 to 184 (121 residues), 27.2 bits, see alignment E=7.9e-10 PF07724: AAA_2" amino acids 104 to 299 (196 residues), 111.1 bits, see alignment E=2.5e-35 PF00004: AAA" amino acids 107 to 232 (126 residues), 56.3 bits, see alignment E=2e-18 PF10431: ClpB_D2-small" amino acids 306 to 381 (76 residues), 42.9 bits, see alignment E=1.6e-14

Best Hits

Swiss-Prot: 64% identical to CLPX_BACTN: ATP-dependent Clp protease ATP-binding subunit ClpX (clpX) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03544, ATP-dependent Clp protease ATP-binding subunit ClpX (inferred from 77% identity to mtt:Ftrac_1139)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpX" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMV5 at UniProt or InterPro

Protein Sequence (407 amino acids)

>CA264_01405 ATP-dependent Clp protease ATP-binding subunit ClpX (Pontibacter actiniarum KMM 6156, DSM 19842)
MAEITCSFCGKNKKDVSVMISGINAHICDRCIGQAQQILNEENKIRASSRAPKFNLMKPK
EMKTYLDQFVVGQDEAKKVMSVAVYNHYKRLMQQPTEDDVVIEKSNIIMVGETGTGKTYL
ARMMAGILQVPFCIADATVLTEAGYVGEDVESILTRLLQAADYNVEAAERGIVYIDEIDK
IARKSDNPSITRDVSGEGVQQALLKLLEGTSVNVPPQGGRKHPEQKMITVNTENILFICG
GAFVGIDRLIKNRLNTRPIGFSKSKLDDMEENENFLKYLTAQDLKNFGLIPELIGRLPVA
THLNPLDKETLRLILLEPKNSIVKQYKRLFEMENINLSFDESALEYIVEKAAEYKLGARG
LRSICEGIMTDAMFELPSEEGTKELVITGDYARDKFEKSGLKQLKVA