Protein Info for CA264_01400 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: lipid-A-disaccharide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02684: LpxB
  • amino acids 4 to 354 (351 residues), 315.1 bits, E=6.1e-98
• TIGR00215: lipid-A-disaccharide synthase
  • amino acids 5 to 362 (358 residues), 271.1 bits, E=6.9e-85
• PF04007: DUF354
  • amino acids 200 to 333 (134 residues), 22.2 bits, E=7e-09

Best Hits

KEGG orthology group: K00748, lipid-A-disaccharide synthase [EC: 2.4.1.182] (inferred from 58% identity to dfe:Dfer_2572)

Predicted SEED Role

"Lipid-A-disaccharide synthase (EC 2.4.1.182)" in subsystem KDO2-Lipid A biosynthesis (EC 2.4.1.182)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (E. coli) (5/6 steps found)
• lipid IV_A biosynthesis (P. putida) (5/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (5/6 steps found)
• lipid IV_A biosynthesis (generic) (5/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (4/6 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (11/17 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (11/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.182

Use Curated BLAST to search for 2.4.1.182

Sequence Analysis Tools

See A0A1X9YMY8 at UniProt or InterPro

Protein Sequence (373 amino acids)

>CA264_01400 lipid-A-disaccharide synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKYYIIAGERSGDLHASNLIKQLHKQDPDAQIRGWGGDMMQAAGMELVRHYQEMAFMGFA
EVFKSLRKIMGFLSEAKADIKRYQPDVVILVDYAGFNMRIARFAKKQGMKVFYYISPKIW
AWNQGRVHGIKKVVDRMFVIMPFEEDFYARFDYKVDYVGNPVNDSVTDHVASNDFRAKNK
LYNNKPIIAILPGSRRQEIENMLHVMLSVLPNFRDYQFVVAGVSNFSKEYYEQYNKDPNI
KIIYDQTYDLLAHAKAALVTSGTATLETALFGVPQVVCYKTSAISYNIGKMVIKVPYISL
VNLIANKPVVTELIQDEFTAKQIVAELKRILFDRHFMQKQQEGYALVRKKIGEFRTAERA
AELMVHYLKEEKV