Protein Info for CA264_01390 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 56 to 76 (21 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 238 to 265 (28 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details PF01032: FecCD" amino acids 13 to 328 (316 residues), 297.7 bits, see alignment E=4.4e-93

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 41% identity to rmr:Rmar_0605)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXN6 at UniProt or InterPro

Protein Sequence (335 amino acids)

>CA264_01390 iron ABC transporter permease (Pontibacter actiniarum KMM 6156, DSM 19842)
MRRVSYFILALLLILVVLVLGLQVGSFDTGIATVFNAFMHYNPADTTQFAILHLRLPRLV
LALVVGASLAFCGYLMQAMVNNGLADPYLLGTAAGASLGAVVVFFGFVPIAVAGFYLPPV
FALAGAFLVTLVVVLLGYRKGQIIPSQLLLGGIALSSLVTAIVGLLTFLSDSEGKLKSVI
FWSMGSFERASWNLVPYPTVALAVALVVFAFYQKQLNVLLLGEERAQALGIRVAQTRWVI
LGTVSVVTGFAVATSGPIGFVGLIIPHITRGLLGTTGRSNLLFCAFVGGLFMLLCDLLSR
IIYPPAGLPIGIITSFFGVPFFVYLLFRKNYNFRG