Protein Info for CA264_01310 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cytochrome-c oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details PF02790: COX2_TM" amino acids 84 to 148 (65 residues), 37 bits, see alignment E=3.1e-13 PF00116: COX2" amino acids 168 to 303 (136 residues), 33.5 bits, see alignment E=3.4e-12

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 56% identity to mtt:Ftrac_3692)

Predicted SEED Role

"Alternative cytochrome c oxidase polypeptide CoxM (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMV6 at UniProt or InterPro

Protein Sequence (357 amino acids)

>CA264_01310 cytochrome-c oxidase (Pontibacter actiniarum KMM 6156, DSM 19842)
MITIAIVLSVLLLLVILYLLFRIGTLASIFRGSSERPAGTTKTSNRVNGTLLLLFLIGGG
AAFAWSFADAWDTMNLPLASVHGEWTDNLFWTTMIIIGVVFVITQILLFFYSYKYQHKDD
KRAYYYPHNNKLEIVWTMIPAVVMALLVFGGWKTWTKITSAAPEDAVVIEIMGKQFNWMV
RYPGEDGKLGVAKHTLIDATNELGVDFSDENALDDIINPLQIHVPKGKPVLLKIRSRDVI
HSVFMPHFRLKMDAVPGMPTKFWFVPSKTTVEMQNETGNPDFKYELACTEVCGRGHFAMR
YVIVVDEPEDYEAWIAEQAPFVEQNPQVLAKFTDGAKKELASKAPAEHAAEEVKTEL