Protein Info for CA264_01215 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 733 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF19081: Ig_7" amino acids 203 to 284 (82 residues), 52.3 bits, see alignment E=5.7e-18 amino acids 290 to 369 (80 residues), 58 bits, see alignment E=9.6e-20 TIGR04183: Por secretion system C-terminal sorting domain" amino acids 655 to 733 (79 residues), 34.7 bits, see alignment E=6.9e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMV3 at UniProt or InterPro

Protein Sequence (733 amino acids)

>CA264_01215 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKRSFTQLFFEAPQSKLKRSTAAYMLFLFCLLASTVATAQTTEVKKMDFSSPDGVSYSLD
AGTGNVSNGVLSVTGRAYDFFLVWGRQYSGYVNVNPSLTLQPGYEYQVSVRARMGGASGK
LEINRGTSAANARSATGTNVILTSSGDNVNSSDYATFTSNKFSVTSSQSLFLALLVDRTT
IWSNTEISLVLDDLIVTQTCISPPTPTAADVIACRTGNSRVTLTASGATTGYGYRWYNQP
TGGAVIATTARYQTPSLSPGEYRYYVSIVNTATGCESNRVLVKAITGSAAPIVSNTSVCP
MGSATLTASGAPAGSTYKWYDTNGNNAIAVATGATYTTGPLTGSKKDYWVSTVNQNNCES
SKSKVTVTVVATPVVQITNPAAVCSPATVNLTAAAIKTGSTNVSAYTYFTDAAATTALAD
PGAVATSGTYYIKGTNSAGCSDIKPVTVVVNPTTALSDIKIPDDIEIGKPATIVLNSEII
DRGHAASFTWYMSIDGGEFVQQAGSTSELSLARVPKGSLQFRCDMTQMSGSCYDATYLQV
RSTPIVPLPVEIIYFTALRQGKDVQLSWATASEENNAGFEVQVSEDGRAFRALGFVGTQN
GDAQVKQSYGYTDTENGKYGTRYYRLRQVDRDGQFAYYTAKAVSFGAVSYSIRAFPNPLE
GDQVSVAVQAEAGGQLQLQVLDAMGRVVASQARELGRGESLERVQLAPALPKGIYFVRTE
MGGVVRSFKLLKK