Protein Info for CA264_01165 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: S-adenosylmethionine:tRNA ribosyltransferase-isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02547: Queuosine_synth
  • amino acids 10 to 401 (392 residues), 336 bits, E=1.1e-104

Best Hits

KEGG orthology group: K07568, S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC: 5.-.-.-] (inferred from 50% identity to pdi:BDI_3759)

Predicted SEED Role

"S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC 5.-.-.-)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.-.-.-)

KEGG Metabolic Maps

• Biosynthesis of steroids
• Carotenoid biosynthesis - General
• Lipopolysaccharide biosynthesis
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-

Use Curated BLAST to search for 5.-.-.-

Sequence Analysis Tools

See A0A1X9YMT6 at UniProt or InterPro

Protein Sequence (403 amino acids)

>CA264_01165 S-adenosylmethionine:tRNA ribosyltransferase-isomerase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTNPKKLAIKDFVYELPDKRIAKFPLPERDQSKLLHYRQGQIVDRTFTDLPQLLPPHTLL
VFNDTKVVQARLLMQKETGGLVEIFCLEPVAPHREVQLAMQQTGSSTWKCLVGNNKRWKS
GPVKLHFEGGILEAAREAQQEGHFLIRFTWDPAELTFAEVLERCGRLPLPPYLNRDLTPD
DHTRYQTIYANQQGAVAAPTAGLHFTARVMHQLQAAGMDTAYLTLHVGAGTFKPVKAEVM
EEHEMHAEQLYITRTFLQRLLRQLDNPVIPVGTTSMRSLESLYWLGAKVLEQPELPMQQL
HVTQWQAYESTNPPAATNALQALLAYMDRQGTDYLHASTQIIIAPGYTFRICRGLVTNFH
QPESTLLLLVSALIGENWRTVYKHALDNGYRFLSYGDSSLLLP