Protein Info for CA264_01145 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: dienelactone hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01738: DLH
  • amino acids 85 to 288 (204 residues), 117.5 bits, E=3.2e-38

Best Hits

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 51% identity to chu:CHU_0997)

Predicted SEED Role

"Dienelactone hydrolase family"

MetaCyc Pathways

• 4-chlorocatechol degradation (2/5 steps found)
• 4,5-dichlorocatechol degradation (3/7 steps found)
• 3,4,6-trichlorocatechol degradation (4/9 steps found)
• 3-chlorocatechol degradation I (ortho) (1/5 steps found)
• 3-chlorocatechol degradation II (ortho) (1/5 steps found)
• 3,5-dichlorocatechol degradation (3/8 steps found)
• 1,4-dichlorobenzene degradation (3/9 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Fluorobenzoate degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.45

Sequence Analysis Tools

See A0A1X9YMU1 at UniProt or InterPro

Protein Sequence (290 amino acids)

>CA264_01145 dienelactone hydrolase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKRTLYILALCLLTFVSARAQGKMTCCAKPKPAEKGQAEATEKFAMLGNDAAFVQKHENP
LPFALQNGKGQRITYQTPDGKTANAYLVKAEKETDEYVFMIHEWWGLNDYIMREAERLAQ
ELGNVNILALDLYDGKVATTQEQAGQFMQAVEEGRARAIINGALQYAGEDADVATIGWCF
GGGWALQTAIMAGDKAEAAVMYYGMPEQNMERLKKLDAPVLGIFASQDQWITPKVVAAFR
QNMEKAGKELTVKMYDADHAFANPSNPKYKAAFADEAHEAAVAFIKEHLD