Protein Info for CA264_01140 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: antibiotic resistance protein MarC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 40 to 62 (23 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 3 to 200 (198 residues), 170.8 bits, see alignment E=1.6e-54 PF01914: MarC" amino acids 3 to 203 (201 residues), 173.5 bits, see alignment E=2e-55

Best Hits

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 44% identity to gfo:GFO_2801)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YY22 at UniProt or InterPro

Protein Sequence (206 amino acids)

>CA264_01140 antibiotic resistance protein MarC (Pontibacter actiniarum KMM 6156, DSM 19842)
MELVLATFSALFTVVNPFGAMPVFLTLTQDDTPHNRNQQALRACIYMALMLSVFFLAGQY
VLNFFGIRLSDIRIAGGLMIMRAGFGLLTSKAHRGRKVSKGVLQEGLEKDDISFTPLAMP
MLSGPGAIAVSIGLYTPALSYSALGLTIFSIALVAAVTFIILRFSHQLISYLGKAGLLAL
SRIMGFIVLAIGVNFISTGVLTLLSR