Protein Info for CA264_01135 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: uroporphyrinogen decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01208: URO-D
  • amino acids 4 to 340 (337 residues), 467 bits, E=1.7e-144
• TIGR01464: uroporphyrinogen decarboxylase
  • amino acids 8 to 339 (332 residues), 439.6 bits, E=3.6e-136

Best Hits

Swiss-Prot: 68% identical to DCUP_CYTH3: Uroporphyrinogen decarboxylase (hemE) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01599, uroporphyrinogen decarboxylase [EC: 4.1.1.37] (inferred from 70% identity to mtt:Ftrac_1932)

MetaCyc: 48% identical to Uroporphyrinogen decarboxylase (Homo sapiens)
Uroporphyrinogen decarboxylase. [EC: 4.1.1.37]; 4.1.1.37 [EC: 4.1.1.37]

Predicted SEED Role

"Uroporphyrinogen III decarboxylase (EC 4.1.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.1.1.37)

MetaCyc Pathways

• superpathway of heme b biosynthesis from glutamate (10/10 steps found)
• superpathway of heme b biosynthesis from glycine (7/8 steps found)
• heme b biosynthesis I (aerobic) (4/4 steps found)
• heme b biosynthesis II (oxygen-independent) (3/4 steps found)
• heme b biosynthesis V (aerobic) (3/4 steps found)
• superpathway of heme b biosynthesis from uroporphyrinogen-III (4/6 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis I (aerobic, light-dependent) (4/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis III (aerobic, light independent) (4/9 steps found)
• heme b biosynthesis IV (Gram-positive bacteria) (1/5 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis II (anaerobic) (3/9 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.37

Sequence Analysis Tools

See A0A1X9YMN3 at UniProt or InterPro

Protein Sequence (346 amino acids)

>CA264_01135 uroporphyrinogen decarboxylase (Pontibacter actiniarum KMM 6156, DSM 19842)
MQLKNDLLIRAAKGEAVERTPVWLMRQAGRILPEYRAVRESLSGFKELVETPDLAAEVTI
QPVDILDVDAAIIFSDILVVPEAMGCTYEMVEKRGPLFPNTIRSEADMKKLRVADPHEHL
NYVLEAIKVTKRALNGRVPLIGFAGAPWTILAYMVEGSGSKTFSHARGMLYTNPKLAHQL
LRMITDTTIAYLQAQVQAGANLIQVFDSWAGILSPAHYREFALPYISEICDAINEVPVTV
FAKGAFFALEDFSKLNCETIGLDWNMEVAKARQQVGPNKTLQGNMDPCLLYSSFDTIERE
TKKMLQEFGPQRHIANLGHGVYPDTDPEKVKCFVQTVKEYGGVISE