Protein Info for CA264_01130 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 85 to 112 (28 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 338 to 363 (26 residues), see Phobius details amino acids 384 to 403 (20 residues), see Phobius details amino acids 438 to 458 (21 residues), see Phobius details amino acids 464 to 482 (19 residues), see Phobius details amino acids 503 to 523 (21 residues), see Phobius details amino acids 533 to 555 (23 residues), see Phobius details amino acids 561 to 581 (21 residues), see Phobius details PF02386: TrkH" amino acids 129 to 581 (453 residues), 185.1 bits, see alignment E=9.4e-59

Best Hits

KEGG orthology group: None (inferred from 47% identity to mtt:Ftrac_1762)

Predicted SEED Role

"Potassium uptake protein, integral membrane component, KtrB" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMQ4 at UniProt or InterPro

Protein Sequence (599 amino acids)

>CA264_01130 ATPase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNTESLNRLLYDSKLTAYKVMRRTTYVLTIVAVGLLLYAHGVVTDQGRLQLLYYAIDGIL
AIFVIIYFLRILYSFEREKFLRRTWFEGVLMSIVFVNQVFTYMLGIPLIYNIFDGIGIPL
SVELYRVIVSMYMLVFLIVELLETRIHLRTMHLDPSITFLLSFVFLILLGSGLFMLPKMT
NSPDGIRFLDALFMATSASCVTGLAVVDPGTYFTFAGQVVLLTLIQFGGLGILTFATFFA
SLMRQGIGVKQHVAMQELMESESLFSTKGLLRQLILLTLTIEGVGAVVLFMLWGPEVQFT
NLGSKIFFSIFHSISAFCNAGFSLYPEGLYTQPVRFSYLLHLTVAMLIIFGGLGIPTIID
IFSPAAMRTRMRMPWKNWKMLTRVIVYTTASLLALGTVGFFLLEYFNTLSHMNFSEALIT
SFFQSVTTRTAGFNTVDISALTVPTLLMFIFLMFIGASPGSTGGGIKTTTFTVILFAVAT
TIRNKRNMEIGYRTIPHSVAYKAFSVFTFAAIINILFVFILSISDAQFDILKLAFEQVSA
FATVGLSTGITAGLSDVGKCVIILSMYLGRVGTLTLALALSTRASTTAYKYPATHLAVG