Protein Info for CA264_01125 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: D-glycero-beta-D-manno-heptose-7-phosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00294: PfkB
  • amino acids 18 to 313 (296 residues), 109 bits, E=1.5e-35

Best Hits

KEGG orthology group: None (inferred from 56% identity to dfe:Dfer_4000)

Predicted SEED Role

"ADP-heptose synthase (EC 2.7.-.-) / D-glycero-beta-D-manno-heptose 7-phosphate kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)

MetaCyc Pathways

• ADP-L-glycero-β-D-manno-heptose biosynthesis (5/5 steps found)

KEGG Metabolic Maps

• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• Lipopolysaccharide biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-

Use Curated BLAST to search for 2.7.-.-

Sequence Analysis Tools

See A0A1X9YMS8 at UniProt or InterPro

Protein Sequence (339 amino acids)

>CA264_01125 D-glycero-beta-D-manno-heptose-7-phosphate kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNQINSLEDIFEAFNGLKVLVVGDVMIDSYLWGKTSRISPEAPVPIVNVVKREKRLGGAA
NVALNVQAMGALPLLCSVIGDDQDGADYLRLMEEKGLPIEGIVQSPERVTTIKHRIIAGA
QQLLRVDSEIEHNLTDYEERHLEERYLQLLEQADVVIFEDYDKGVFSKQNIQRFLELANE
RRVPSVIDPKKKNFLSYVGCTLFKPNLKELKEGLKVDFADENLPAFEAAVEELQQQLQVK
QVLVTLSERGVFIADGDEKTYIGAHRRSISDVSGAGDTVISIAALCMALKTSLSFMAGLS
NLGGGLVCEHVGVVPVDKQKLYEEAQRIRLFETHEHRIT