Protein Info for CA264_01055 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 233 to 256 (24 residues), see Phobius details amino acids 264 to 289 (26 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 390 to 390 (1 residues), see Phobius details amino acids 393 to 417 (25 residues), see Phobius details PF00375: SDF" amino acids 57 to 444 (388 residues), 383.4 bits, see alignment E=6.4e-119

Best Hits

Swiss-Prot: 40% identical to DCTA_PARP8: C4-dicarboxylate transport protein (dctA) from Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)

KEGG orthology group: K11102, proton glutamate symport protein (inferred from 67% identity to psn:Pedsa_1232)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMR9 at UniProt or InterPro

Protein Sequence (478 amino acids)

>CA264_01055 dicarboxylate/amino acid:cation symporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKSLLPLATLLCVTVAAILTVLQQYSLISLPTEALMAVRWAGIGVLLLYGLQKRSLTSW
ILISMVVGAEIGYDFPEFAVNLNVLSKVFLKLIKTIIAPLIFATLVVGIAGHSNLKQVGS
MGWKAIVYFEIVTTLALFIGLAAINLSRAGEGIDAGLAASHEELAPVAAQSTSEIILHVF
PENIAKSVVEGQVLQIVVFSVLFAIGLAMVNEKKRKPMLDFCESLSETMFKFTNVIMYFA
PVGVGAAIAYTVGHMGFGILLNLFQLLATLYVALLAFALLVLLPVALIARVPVRRFLKAI
SGPVSIAFATTSSEAALPRAMEEMEKLGVPRKIVAFVMPTGYSFNLDGTTLYLALASVFV
AQAAGINMTWEQQLVMVFTLMLTSKGVAGVPRASLVILLGTVASFNLPVWPVFAILGIDE
LMDMARTSVNVTGNCLATAVVARWEGEFNPQPESGLVETTIPELQQNQQETDRTPELV