Protein Info for CA264_00960 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 28 to 465 (438 residues), 366.7 bits, see alignment E=1.1e-113 PF13727: CoA_binding_3" amino acids 146 to 238 (93 residues), 30.8 bits, see alignment E=2.9e-11 PF02397: Bac_transf" amino acids 275 to 457 (183 residues), 218.8 bits, see alignment E=4.1e-69

Best Hits

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.6

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YML9 at UniProt or InterPro

Protein Sequence (466 amino acids)

>CA264_00960 exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MIKYKSYSGTVSDGGYFVAVLLLIYLLNKYSDISLEWAIVIGVLFVVLNFLSMYAPHIAK
NKVGNAAANYMKLPLILILTVLVLLSSSEFYESVSVVSVMLLIALPVLGIPIQALVMKMA
RSKTASEDKGVHMSSLAPSVKAKSTLVAGIGSMAVNVEKHLQAHSKTPRHIKGFIKCKKE
ESVVTNDRIIGDLESIHSYLSENPVDEIVIALPVKPSKKVKSIIEVADYHGIRVKYVPDY
QGLLGTNYKITRYGHIDAINVRQVPLDDPLAFWVKNSFDKVFAFLALVALSPLFLVIALL
IKLDSPGPLFYCPIRTGKAGKQFRIYKFRSMRCNDDESKGTLSTKQNDERITKVGKVLRK
YSLDELPQFLNVLLGDMSVVGPRPHRNFLNKQFQISEKRYMVRHYFKPGITGWAQINGWR
GPTETQEQKSQRTLHDLWYIENWTLWLDMKIIYLTIFGRKTHQGAF