Protein Info for CA264_00880 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: orotidine 5'-phosphate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 63% identical to PYRF_FLAJ1: Orotidine 5'-phosphate decarboxylase (pyrF) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K01591, orotidine-5'-phosphate decarboxylase [EC: 4.1.1.23] (inferred from 64% identity to lby:Lbys_3332)

Predicted SEED Role

"Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23)" in subsystem De Novo Pyrimidine Synthesis (EC 4.1.1.23)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
UMP biosynthesis II (6/6 steps found)
superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
UMP biosynthesis I (5/6 steps found)
UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMK8 at UniProt or InterPro

Protein Sequence (275 amino acids)

>CA264_00880 orotidine 5'-phosphate decarboxylase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTREQLFEQILKKKSYLCIGLDTDPLKLPQHLLDFEDPVFEFNRQIIEATADLCVAYKPN
IAFYEAQGPQGWVSLQKTLEVIPKEVFTIADAKRGDIGNTSELYARAFFENMDFDSVTVA
PYMGADSVKPFLTQGGKFVVLLALTSNAGSQDFQMLRLEDGSEEYLFEQVLRTSQEWGNA
DNMMYVVGATQAEYVQRVRRIVPDSFLLVPGVGAQGGSLADISRLGMNRQCGLLVNSARA
IIYASSGFDFAERAREAAFAVQREMEALLEELLVG