Protein Info for CA264_00865 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: dihydroorotate dehydrogenase (quinone)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR01036: dihydroorotate dehydrogenase (fumarate)" amino acids 4 to 340 (337 residues), 415 bits, see alignment E=1e-128 PF01180: DHO_dh" amino acids 50 to 341 (292 residues), 285.5 bits, see alignment E=2.3e-89

Best Hits

Swiss-Prot: 64% identical to PYRD_GRAFK: Dihydroorotate dehydrogenase (quinone) (pyrD) from Gramella forsetii (strain KT0803)

KEGG orthology group: K00226, dihydroorotate dehydrogenase (fumarate) [EC: 1.3.98.1] (inferred from 63% identity to mtt:Ftrac_1484)

Predicted SEED Role

"Dihydroorotate dehydrogenase (EC 1.3.3.1)" in subsystem De Novo Pyrimidine Synthesis (EC 1.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.1 or 1.3.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMK5 at UniProt or InterPro

Protein Sequence (343 amino acids)

>CA264_00865 dihydroorotate dehydrogenase (quinone) (Pontibacter actiniarum KMM 6156, DSM 19842)
MYKSLLRPLLFQLDPEKVHYLSTDALRASMKLPFARSMAESMFKVNDPRLERELFGLTFP
NPVGLAAGFDKDAMLVDELAELGFGFVEIGTLTPKPQPGNEKPRLFRLPEDKAIVNRMGF
NNKGVDAAVRRLEKRKSNIIVGGNIGKNKVTPNEEALSDYLYCFKALFHVVDYFVVNVSS
PNTPDLRALQDKEPLQRLLVSLQEENQKMGTPKPLLLKIAPDLNLNQLNDIIEIAIEAKL
SGIIGTNTTVSRQGLLTPEARVQEIGMGGLSGKPLTTHSTQIIRHLRTFLPPEIRLIGVG
GIMTAADAVEKMNAGADLVQLYTGFIYEGPSLISQINKKLLSR