Protein Info for CA264_00850 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: site-specific tyrosine recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF02899: Phage_int_SAM_1" amino acids 7 to 90 (84 residues), 61.3 bits, see alignment E=1.8e-20 TIGR02225: tyrosine recombinase XerD" amino acids 8 to 298 (291 residues), 352 bits, see alignment E=1.3e-109 PF13102: Phage_int_SAM_5" amino acids 8 to 98 (91 residues), 24.2 bits, see alignment E=7.4e-09 PF13495: Phage_int_SAM_4" amino acids 8 to 88 (81 residues), 30.4 bits, see alignment E=8.7e-11 PF00589: Phage_integrase" amino acids 114 to 284 (171 residues), 158.5 bits, see alignment E=3e-50

Best Hits

Swiss-Prot: 42% identical to XERD_LISIN: Tyrosine recombinase XerD (xerD) from Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 70% identity to chu:CHU_2702)

Predicted SEED Role

"Tyrosine recombinase XerD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YML6 at UniProt or InterPro

Protein Sequence (299 amino acids)

>CA264_00850 site-specific tyrosine recombinase XerD (Pontibacter actiniarum KMM 6156, DSM 19842)
MNWRICIKQFEEYLKLEKSLSRHSVEAYERDVRKLVDFMDAKGLQVAPEDMKPAILRDFL
EWINELGMTPHSQARTLSGIRAFYKFLIMEDMMQTDPTDTIEAPKLDRKLPDTLAFHEIE
QLLSAIDLSTPEGTRNRAMLETLYSSGLRVSELLDLRISNLYADAGFLKISGKGEKERLV
PIGRDALKHIQLYRDGIRCHLNIKKGNEDILFLNRRGAKMSRVMVFTIIKDLTAKAGIQK
TVSPHTFRHSFATHLIEGGADLRAVQEMLGHESITTTEIYTHLDRDYLKQVIKEFHPRS