Protein Info for CA264_00820 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: saccharopine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF03435: Sacchrp_dh_NADP" amino acids 4 to 121 (118 residues), 51.3 bits, see alignment E=1.5e-17 PF16653: Sacchrp_dh_C" amino acids 126 to 437 (312 residues), 286.6 bits, see alignment E=3e-89

Best Hits

KEGG orthology group: None (inferred from 55% identity to cat:CA2559_01665)

Predicted SEED Role

"Saccharopine dehydrogenase [NADP , L-glutamate-forming] (EC 1.5.1.10)" in subsystem Lysine degradation (EC 1.5.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMI8 at UniProt or InterPro

Protein Sequence (449 amino acids)

>CA264_00820 saccharopine dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKILLLGAGRSASSLIKYLFDNATSESWYITIGDINVAHLQPLVEPVAFAQTITFDVHN
DVQRAEEVSKADLVISLLPAIFHIEVAKECLKQERNLITASYVSSAFLALHEEAQQKNLS
IIMESGLDPGIDHMSAMRVIRSIKEAGGKLTSFKSYTGGLVAPESDNNPWRYKFTWNPRN
VVLAGQGTAKYIKQGQYKYIPYHKLFKRTDELFVEGYGHFDGYANRDSLSYREPYGLLDI
PTMLRGTLRRQGYCEAWDVFVQLGLTDDSYTLDGSDQMTYRTFVESFLPPATSPGQPMAE
RISLYLGVPADGEVMEKLAWLGLFEDTPVELAAATPAQVLEKILKEKWTLAPGDKDMIVM
QHLFAYELNGEQREVTSTLVAMGDDEVQTAMAKTVGLPVGILAKLMLQGKITHRGVVIPI
YPELYEPVLEELEEHGIKFVEQERVVAEV