Protein Info for CA264_00815 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cytidine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08211: dCMP_cyt_deam_2
  • amino acids 20 to 85 (66 residues), 45.1 bits, E=1.2e-15
• PF00383: dCMP_cyt_deam_1
  • amino acids 22 to 125 (104 residues), 61.8 bits, E=5.2e-21
• TIGR01354: cytidine deaminase
  • amino acids 25 to 159 (135 residues), 124.6 bits, E=1.4e-40

Best Hits

KEGG orthology group: K01489, cytidine deaminase [EC: 3.5.4.5] (inferred from 54% identity to fbc:FB2170_17371)

Predicted SEED Role

"Cytidine deaminase (EC 3.5.4.5)" in subsystem Murein hydrolase regulation and cell death (EC 3.5.4.5)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleoside salvage (9/9 steps found)
• superpathway of pyrimidine ribonucleosides salvage (9/10 steps found)
• pyrimidine deoxyribonucleosides salvage (5/5 steps found)
• pyrimidine deoxyribonucleosides degradation (3/3 steps found)
• pyrimidine ribonucleosides salvage I (3/3 steps found)
• pyrimidine ribonucleosides degradation (2/2 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (4/6 steps found)
• pyrimidine ribonucleosides salvage II (1/2 steps found)
• superpathway of pyrimidine ribonucleosides degradation (2/5 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.5

Sequence Analysis Tools

See A0A1X9YMJ7 at UniProt or InterPro

Protein Sequence (160 amino acids)

>CA264_00815 cytidine deaminase (Pontibacter actiniarum KMM 6156, DSM 19842)
MASELKVQISVDVLDPAELNAQEQQAMQLAQEAAKDAYAPYSNFLVGAALLLEDGTMFKG
SNQENAAYPSGLCAERTALFALSAHHPHTTIKLLAVTARRRQEENFLPAMPCGACRQVMA
EYEFKQQEPIPVLLQAPDGRFYRFKSVADLLPFQFTKEHL