Protein Info for CA264_00815 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cytidine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF08211: dCMP_cyt_deam_2" amino acids 20 to 85 (66 residues), 45.1 bits, see alignment E=1.2e-15 PF00383: dCMP_cyt_deam_1" amino acids 22 to 125 (104 residues), 61.8 bits, see alignment E=5.2e-21 TIGR01354: cytidine deaminase" amino acids 25 to 159 (135 residues), 124.6 bits, see alignment E=1.4e-40

Best Hits

KEGG orthology group: K01489, cytidine deaminase [EC: 3.5.4.5] (inferred from 54% identity to fbc:FB2170_17371)

Predicted SEED Role

"Cytidine deaminase (EC 3.5.4.5)" in subsystem Murein hydrolase regulation and cell death (EC 3.5.4.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMJ7 at UniProt or InterPro

Protein Sequence (160 amino acids)

>CA264_00815 cytidine deaminase (Pontibacter actiniarum KMM 6156, DSM 19842)
MASELKVQISVDVLDPAELNAQEQQAMQLAQEAAKDAYAPYSNFLVGAALLLEDGTMFKG
SNQENAAYPSGLCAERTALFALSAHHPHTTIKLLAVTARRRQEENFLPAMPCGACRQVMA
EYEFKQQEPIPVLLQAPDGRFYRFKSVADLLPFQFTKEHL