Protein Info for CA264_00770 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: prolipoprotein diacylglyceryl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 206 to 223 (18 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 10 to 259 (250 residues), 181.8 bits, see alignment E=8.9e-58 PF01790: LGT" amino acids 13 to 258 (246 residues), 252.2 bits, see alignment E=2.2e-79

Best Hits

Swiss-Prot: 51% identical to LGT_CHLT3: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Chloroherpeton thalassium (strain ATCC 35110 / GB-78)

KEGG orthology group: None (inferred from 53% identity to dfe:Dfer_4316)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMJ3 at UniProt or InterPro

Protein Sequence (283 amino acids)

>CA264_00770 prolipoprotein diacylglyceryl transferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNILNYILWNVDPDIFSIGPLTIRWYGLLFALGFVFGQRILTKIYVAEGRTEGDVDVITL
YMIIGTVIGARLGHTLFYAPDYYLSNPIEILKIWEGGLASHGATIGILFALWLFSRKQKF
DYMWVLDRIVIVVALGGALIRMGNLMNSEIIGRPTDVPWAFEFVRLGENPVVPRHPTQLY
ESLSVFALFVLLYWLWSKYKSALPKGLLFGIFVTALFTFRFLVEFLKENQEAFEDNLTLN
MGQILSIPLIIAGLFILFRVWQNPTPALPGGRLPEKEKEKRKV