Protein Info for CA264_00745 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR02191: ribonuclease III" amino acids 30 to 242 (213 residues), 203.4 bits, see alignment E=1.6e-64 PF14622: Ribonucleas_3_3" amino acids 38 to 163 (126 residues), 115.3 bits, see alignment E=3.4e-37 PF00636: Ribonuclease_3" amino acids 62 to 149 (88 residues), 78.4 bits, see alignment E=9.5e-26 PF00035: dsrm" amino acids 179 to 243 (65 residues), 49 bits, see alignment E=1.2e-16

Best Hits

Swiss-Prot: 40% identical to RNC_FLAPJ: Ribonuclease 3 (rnc) from Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 59% identity to sli:Slin_5150)

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMI7 at UniProt or InterPro

Protein Sequence (246 amino acids)

>CA264_00745 ribonuclease III (Pontibacter actiniarum KMM 6156, DSM 19842)
MFGPFKPVRRAYHRLFNKDKVLVRALAGIIGSTPDNLRLYRLALTHTSFARQTAAGKHET
NERLEFLGDAVLGAVVAEHLFKKFPYEDEGFLTEIRSRIVNRESLNQIAVKIGLNLLVKV
DTSNHGMRHKSVNGNALEALVGAIYLDKGYNTTRMFILSKLVKPHVDIHNLVNTTANFKS
KLIEWAQSQNLEIRFDIIKRKQQGNTTEFTSEVYIDDKPIAVGIGLSKKKADQAAAEKGL
EALKIS