Protein Info for CA264_00740 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: beta-ketoacyl-[acyl-carrier-protein] synthase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 49% identical to FABF_ECOL6: 3-oxoacyl-[acyl-carrier-protein] synthase 2 (fabF) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K09458, 3-oxoacyl-[acyl-carrier-protein] synthase II [EC: 2.3.1.179] (inferred from 76% identity to fte:Fluta_1899)

MetaCyc: 49% identical to (5Z)-3-oxo-dodec-5-enoyl-[acp] synthase (Enterococcus faecalis)
Beta-ketoacyl-acyl-carrier-protein synthase II. [EC: 2.3.1.179, 2.3.1.41]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASII (EC 2.3.1.179)" (EC 2.3.1.179)

MetaCyc Pathways

superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
oleate biosynthesis IV (anaerobic) (13/14 steps found)
superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
biotin biosynthesis I (13/15 steps found)
palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
gondoate biosynthesis (anaerobic) (4/4 steps found)
8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
(5Z)-dodecenoate biosynthesis I (5/6 steps found)
cis-vaccenate biosynthesis (4/5 steps found)
fatty acid elongation -- saturated (4/5 steps found)
superpathway of fatty acid biosynthesis initiation (4/5 steps found)
octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
palmitate biosynthesis III (21/29 steps found)
(5Z)-dodecenoate biosynthesis II (4/6 steps found)
stearate biosynthesis II (bacteria and plants) (4/6 steps found)
anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
fatty acid biosynthesis initiation (mitochondria) (2/4 steps found)
petroselinate biosynthesis (3/6 steps found)
stearate biosynthesis IV (3/6 steps found)
streptorubin B biosynthesis (20/34 steps found)
tetradecanoate biosynthesis (mitochondria) (12/25 steps found)
mycolate biosynthesis (23/205 steps found)
superpathway of mycolate biosynthesis (24/239 steps found)

KEGG Metabolic Maps

Fatty acid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.179 or 2.3.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMJ0 at UniProt or InterPro

Protein Sequence (417 amino acids)

>CA264_00740 beta-ketoacyl-[acyl-carrier-protein] synthase II (Pontibacter actiniarum KMM 6156, DSM 19842)
MELKRVVVTGLGALTPLGNTVSEYWNGLINGVSGAAPITRFDASKFKTQFACEIKGYDPE
KYFDRKEARKMDLFTQFAMIVADEAVSDAMLTEGSYDPDRVGVVWGSGIGGLRTFQEECV
NFANGDGTPRFNPFFIPKMIADISAGQISIKHGFRGPNFVTVSACASATNAIIDSFNYIR
LGMADAIVTGGSEAAVTEAGIGGFNALKALSERNDSPATASRPFDADRDGFVLGEGAGAL
ILEEYEHAKARGAKIYAEIIGGGMSADAYHITAPHPEGLGALNVMKNVLRDANIKPEEVD
YINVHGTSTPLGDISEVKAIQTVFGEHAYDLNISSTKSMTGHLLGAAGAIEAIASIMAVR
NNIVPPTINHFTDDDKIDNRLNFTFNKAQEREVKVAMSNTFGFGGHNTSVIFRQLND