Protein Info for CA264_00725 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: pyruvate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00224: PK
  • amino acids 6 to 327 (322 residues), 405.5 bits, E=2.6e-125
• TIGR01064: pyruvate kinase
  • amino acids 7 to 473 (467 residues), 535.8 bits, E=4.1e-165
• PF03328: HpcH_HpaI
  • amino acids 180 to 281 (102 residues), 26.4 bits, E=6.2e-10
• PF02887: PK_C
  • amino acids 361 to 471 (111 residues), 104.2 bits, E=7.2e-34

Best Hits

KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 58% identity to mtt:Ftrac_1175)

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• homolactic fermentation (11/12 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• Bifidobacterium shunt (12/15 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis IV (8/10 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• Entner-Doudoroff pathway I (6/9 steps found)
• glycerol degradation to butanol (11/16 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (11/17 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (5/9 steps found)
• mixed acid fermentation (10/16 steps found)
• heterolactic fermentation (11/18 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)
• superpathway of N-acetylneuraminate degradation (11/22 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis
• Purine metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.40

Use Curated BLAST to search for 2.7.1.40

Sequence Analysis Tools

See A0A1X9YMI9 at UniProt or InterPro

Protein Sequence (475 amino acids)

>CA264_00725 pyruvate kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MDISFNKTKVLATVGPASNSYERLVALVQEGVDAFRLNFSHGAYEEHQKVINHVREVNRQ
YNTNICLVQDLQGPKIRLGDVENGSVEIVEGQRVKLVCDGSISTADRLSTIYTGLAKDVN
EGDAILLDDGKLELRVISTDKELEVITEVVYGGIVKPRKGINLPNSRVSAPSLTEKDVED
LHFGLDNDVEWVALSFVRKVEDIHEIKRIIRERGKDTRVIAKIEKPEAIENIDEIIGAVD
AIMVARGDLGVEVGMEKVPMIQKMLVEKCNQAAKPVIVATQMMESMIVNPRPTRAETNDV
ANAVLDGAHCLMLSAETAVGAYPIETIRSMNLTIRMVEEHSHVFNRSFASNPESPTFLSD
SLVANACNLASDTNAKAIIGMTKSGYTAFQLAKYRPKADIFVFTENHRLLNTLNLVWGVR
GFFYNKFESTDSTILDIKQILLDGGYIKKGDVFINTASMPINEQKRTNMIKLSVA