Protein Info for CA264_00580 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: aminoacyl-tRNA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR00447: aminoacyl-tRNA hydrolase" amino acids 4 to 185 (182 residues), 192.2 bits, see alignment E=3.4e-61 PF01195: Pept_tRNA_hydro" amino acids 4 to 185 (182 residues), 221 bits, see alignment E=5.6e-70

Best Hits

Swiss-Prot: 63% identical to PTH_CYTH3: Peptidyl-tRNA hydrolase (pth) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01056, peptidyl-tRNA hydrolase, PTH1 family [EC: 3.1.1.29] (inferred from 63% identity to chu:CHU_2625)

Predicted SEED Role

"Peptidyl-tRNA hydrolase (EC 3.1.1.29)" (EC 3.1.1.29)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YY40 at UniProt or InterPro

Protein Sequence (187 amino acids)

>CA264_00580 aminoacyl-tRNA hydrolase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKYLIVGLGNIGPEYADTRHNIGFMVLDYLARKYEGNFDVSRHAFVTEIKTKGRTFVLVK
PTTYMNLSGKAVGHYLSSLKLTPDQMLVITDDIAIPFGKLRIRAKGSAGGHNGLKHIEQT
LGHNNYPRLRFGVGDNFHKGKQVDYVLDKFGEEEQPELQTLIEKAADAVIAFGTIGLERT
MNQYNTK