Protein Info for CA264_00575 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 313 to 335 (23 residues), see Phobius details amino acids 347 to 367 (21 residues), see Phobius details amino acids 378 to 398 (21 residues), see Phobius details PF07690: MFS_1" amino acids 31 to 303 (273 residues), 126.9 bits, see alignment E=9.4e-41 amino acids 283 to 404 (122 residues), 45.1 bits, see alignment E=7e-16 PF05977: MFS_3" amino acids 88 to 404 (317 residues), 29.6 bits, see alignment E=2.7e-11

Best Hits

KEGG orthology group: None (inferred from 38% identity to fjo:Fjoh_2773)

Predicted SEED Role

"Probable multidrug resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMF3 at UniProt or InterPro

Protein Sequence (422 amino acids)

>CA264_00575 MFS transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKVLLLYRNAFGGLSRPAWMMSLVMLINRSGAMVTPFLSVYLTEVLGYTLREAGIILSM
YGLGSVCGAYLGGWLTDKVGHFKVQFLSLTVGGSLYFMLLHLQAFAALAAGVFILSLVND
TLRPANSSSIASYARPENVTRAFSLNRMALNLGFSIGPALGGLLAAVSYQWLFIADGTTC
IMAGLFFYIYFKNKQGNNTPENTAQASAAPAVRLRSPYRDGYFLLFAVFCCCFAMMFFQL
LSTLPLYYRQVYTLPESRIGGLLALNGLIVFLLEMVVVYLLGEKAKKSWLIVMGTLVLGF
SFVLLNLTQHLSILYAAMFLLSIAEILAMPFMATITVERSGPTNRGAYMGLYTISYAAAH
VVAPYLGTTIASTYGFATLWWATGALSLVTALGLYFVVQHIEGERTARAAVAASEAKGIA
IG