Protein Info for CA264_00515 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 85 to 106 (22 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 328 to 346 (19 residues), see Phobius details amino acids 363 to 386 (24 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 61 to 381 (321 residues), 115.2 bits, see alignment E=1.7e-37

Best Hits

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YME9 at UniProt or InterPro

Protein Sequence (415 amino acids)

>CA264_00515 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MWQAFLLWVALFRLLKGIFVCTLAHQTSISKPMSAVTRKAFKRVLFPQLRLSPISAGQKV
EALDGIRGLAILAVLCYHCTSFFPLGWVGVDLFFVLSGFLLTNILLQRRQESGYFRSFYA
KRALRILPLYALILWAACIFSVIYATELPHISYFFFLQNVSTALANAFPGNTHHLNHLWS
IAVEEQFYLILPLAVYFLAARNYLLFLFALLVTALLSRSLLFWEGNLGYYVLLTSRMDAL
AFGSLAALLLQHHREVLNRWTLPLLYASAGILLVAVLTEGPGYDNPYLATAGYTLFALLF
SCLLTVSLSTHPRNAVRQLFRTRTLRALGKYSFGLYIYHWPLFRLFTDPLKHHLKGYIPG
QYLSLSVALLLAATTAIVTLLSYHLVEVRFLRLKKKVARKASGSADLEPTGSIKV