Protein Info for CA264_00500 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 778 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 25 to 92 (68 residues), 56.3 bits, see alignment E=6.9e-19 PF13715: CarbopepD_reg_2" amino acids 26 to 111 (86 residues), 66.8 bits, see alignment E=2.9e-22 PF07715: Plug" amino acids 120 to 223 (104 residues), 64.7 bits, see alignment E=2.1e-21 PF00593: TonB_dep_Rec" amino acids 321 to 743 (423 residues), 109.9 bits, see alignment E=6e-35

Best Hits

KEGG orthology group: None (inferred from 49% identity to phe:Phep_0763)

Predicted SEED Role

"Aerobactin siderophore receptor IutA" in subsystem Iron acquisition in Vibrio or Siderophore Aerobactin or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMF2 at UniProt or InterPro

Protein Sequence (778 amino acids)

>CA264_00500 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MQRTLLLFALLLFCALATQAQDLRTVTGTVHDAAGQPVPMLTVALEGTTIGANTNDNGYF
ELKGIQPGTYTLRVGGVGYGSIRQQVDLTNSNANFDLSIKQTQQALQEVIVSAGRTVEAL
DETPASVYVLNSRALQVQSQISTNISNILAQTVPGLAINSNTTSNVGQTLRGRNVLVMID
GIPQSTPLRNGSRDVRTIDPAAIERVEIVKGATAVYGNGADGGLINYITKRADANKPFSA
YTSVAGTGMLFNSDNTLGGRISQQFSGKAGGLDYVASGTYEKTGVFKDGEGDVISPVYGL
GETKMYNGFGKLGYNFNEKHRVEAMYNYFGSGQNSDYVEQLGKYGEAPTIGVKGEHKGKD
EGTRYNHNAQVRYIGKDLFINSSLELSTYLQSFYTVYGWTSYFENGGQSTIKSNKKGVRL
NLNTPFALGMAKGSLTYGVDYLNDVTSQPLVDGRTWVPEMDLKNVAPYAQLNLNLNQDFI
FKAGYRYDNVKVGVDDFQQLVLASGAGGESVQGGTLKFDAHTFNVGFRYVGIEAIKPFVS
YSQGFSMIDVGRYVRSAKENFISQMDLEPVIVNNYEAGFHSRLGIVSFSGAYFISTSKLG
ANLKANADGVYEIERAPERVEGVEALVDVFVSDKITFGANAAYSEGKADINNNSECSDAE
DKYLTGLRIPPLKITSYLNVKPVEKLNLNLQWIYSGDRDRFERNAKGGYSSGEGPVKAFD
IFNLAASYQATTKLSLNLGIENLLNNAYYLPQAYWYGRDDNFTRASGARFQVGASYNW