Protein Info for CA264_00490 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 797 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 35 to 110 (76 residues), 63.2 bits, see alignment E=4.8e-21 PF13715: CarbopepD_reg_2" amino acids 36 to 122 (87 residues), 73.9 bits, see alignment E=1.8e-24 PF07715: Plug" amino acids 144 to 241 (98 residues), 45.1 bits, see alignment E=2.5e-15 TIGR01783: TonB-dependent siderophore receptor" amino acids 146 to 797 (652 residues), 321.3 bits, see alignment E=7.7e-100 PF00593: TonB_dep_Rec" amino acids 350 to 757 (408 residues), 161.7 bits, see alignment E=1.1e-50

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 56% identity to sli:Slin_5755)

Predicted SEED Role

"TonB-dependent siderophore receptor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMF0 at UniProt or InterPro

Protein Sequence (797 amino acids)

>CA264_00490 TonB-dependent siderophore receptor (Pontibacter actiniarum KMM 6156, DSM 19842)
MKRTSILAFRGALPLALSLLFVLVSSIAALAQSGTIKGHITTTDSQPAIGVSIGLEGTVI
GTTTDAQGNYTINRVKPGNYTLRVQMLGLEPQEQYVQVDNGKTSTANFTLVESASKLQEV
IITSQRDKYKASLPSESLRLQTPLLETPQNIQIITNDVLKDQQVFTLLEGVTRNVSGVTM
QEHWGNYTRMNMRGARVAPFRNGMNVESNWGPLSEDMSFVERIEFVKGPAGFMLANGDPA
GFYNIVTKKPTGTPKQEVSLSFGSYETFRAAADLDGKLTKDGKLLYRLNLMGQTNESWRD
YESNDRYAVAPVLKYRFSDKTSLTAEYTYQFSRMSAIGSAYVFSANGFEDLPRSFTIADP
NLEPSDMKDHNAYLIFEHKLNDNWKLTAQTAYFYYNQEGSSLWAAGVDASGNMKRTLSGW
DAQNKSKFGQLFVNGEFETGTVSHKILGGLDLGDKEYLADWSQYFVLDPEAPFNVYNPVY
GNIAIPTLDHSVALEDRPTVSTLGQKYGALYLQDELGFFDDKLRLTLAGRYTKAETNQYT
TIIKNEKFTPRVGISGSISKSLSVYALFDQAFIPQTGLLASGDQVDPITGNNLEVGVKKD
WFNGRWNSTLSVYQITKKNQLIGDPTDPTGTYSLQMGESQTKGAELDVRGEIVPGLNLTF
NYAYTNSEATEESTEFKPGDKVPGFAEHITNAWLSYKLPVSPLKGLGVSLGYQWQVNRYP
WFASGDGGSELPDYFRLDGGLSYQIKNVRLALNVNNLLDDYLYSGAPYDFNYDGTNDGYY
WQTEAPRSYRVTIGYRF