Protein Info for CA264_00485 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: peptidase M4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 340 to 365 (26 residues), see Phobius details PF03929: PepSY_TM" amino acids 9 to 367 (359 residues), 224.1 bits, see alignment E=3.5e-70 PF03413: PepSY" amino acids 57 to 113 (57 residues), 25.8 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: None (inferred from 53% identity to dfe:Dfer_4666)

Predicted SEED Role

"putative iron-regulated membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMC9 at UniProt or InterPro

Protein Sequence (395 amino acids)

>CA264_00485 peptidase M4 (Pontibacter actiniarum KMM 6156, DSM 19842)
MSIKKLIGKVHLWLGFASGLLVLFLGITGCILSFQREIEDATQEYRFVEHQPGKALLPPS
ELRAIADSQLPGKKTHSVSYQKGKAALVVYYDFEPEYYYTVYLNPYTGDVLKVKNMAHDF
FRIIIEGHYYLWLPPNIGQPILASATLIFVVLLITGIILWWPKNKSAAKQRFSIKWSAKW
RRKNYDLHNVLGFYMSWVVIFIAITGLVWGFQWVSKSVYWATSGGKPINEYYETLSDTTK
ASPLASTPAIDLLWDKVRKENPAFTGSLEVHIPENKKTSIEIASNPDTDTYWKIDYRYFD
QHTLQELPVTHMYGKLADASVADKIRRMNYDIHVGAIGGIVGKIIAFFASLLAASMPVTG
TLIWWGRRKKAARKVAKPEPQQQARRLQRPRAVKA