Protein Info for CA264_00460 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 3 to 190 (188 residues), 195.9 bits, E=1e-61
• PF01370: Epimerase
  • amino acids 6 to 164 (159 residues), 23.7 bits, E=5.8e-09
• PF08659: KR
  • amino acids 6 to 165 (160 residues), 49.2 bits, E=1.2e-16
• PF13561: adh_short_C2
  • amino acids 9 to 223 (215 residues), 149.4 bits, E=2.6e-47

Best Hits

Swiss-Prot: 48% identical to YDFG_SALTY: NADP-dependent 3-hydroxy acid dehydrogenase YdfG (ydfG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 65% identity to mtt:Ftrac_3231)

MetaCyc: 46% identical to 3-hydroxy acid dehydrogenase YdfG (Escherichia coli K-12 substr. MG1655)
RXN-16000 [EC: 1.1.1.381]; RXN-8974 [EC: 1.1.1.381, 1.1.1.298]; Serine 3-dehydrogenase. [EC: 1.1.1.381, 1.1.1.298, 1.1.1.276]

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

MetaCyc Pathways

• L-threonine degradation III (to methylglyoxal) (2/3 steps found)
• β-alanine degradation III (1/2 steps found)
• uracil degradation III (3/5 steps found)
• aminopropanol phosphate biosynthesis II (2/4 steps found)
• 3-hydroxypropanoate cycle (8/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• superpathway of L-threonine metabolism (10/18 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.276 or 1.1.1.298 or 1.1.1.381

Sequence Analysis Tools

See A0A1X9YMF7 at UniProt or InterPro

Protein Sequence (250 amino acids)

>CA264_00460 NAD(P)-dependent oxidoreductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTKIAFVTGATSGIGLATALELAGKGYRIIATGRRQDRLQELQQKLGEGQVYPLTFDVRD
KLAVQEAVASLPQEWRKVEVLVNNAGNAHGLAPIQDGSLDDWDAMIDINVKGLLYVTKAV
LPLMQEQRKGHIVNIGSIAGKEVYPNGNVYCASKHAVDALSKAMRIDLVEQGIKVSEVNP
GLVETEFSEVRFKGDTERAATVYQGYAPLQAQDIAELIGFIVTRPAHVNLAEVLVLPAAQ
ASATIVTKQQ