Protein Info for CA264_00420 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: fructose-bisphosphatase class I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF00316: FBPase" amino acids 12 to 200 (189 residues), 247 bits, see alignment E=1.2e-77 PF18913: FBPase_C" amino acids 205 to 328 (124 residues), 165 bits, see alignment E=7e-53

Best Hits

Swiss-Prot: 64% identical to F16PA_AERHH: Fructose-1,6-bisphosphatase class 1 (fbp) from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)

KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 71% identity to mtt:Ftrac_2848)

MetaCyc: 59% identical to fructose-1,6-bisphosphatase 1 (Escherichia coli K-12 substr. MG1655)
Fructose-bisphosphatase. [EC: 3.1.3.11]

Predicted SEED Role

"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YMD6 at UniProt or InterPro

Protein Sequence (335 amino acids)

>CA264_00420 fructose-bisphosphatase class I (Pontibacter actiniarum KMM 6156, DSM 19842)
MNDKLALPVGTTLDRFIMRKQEAFPYATGELSQLLRDIALAAKIVNREINRAGLLDVTGA
YGQQNVQGEDQQKLDVIANIRFIRALRNGGEVCTIISEEEDDIIQTGNIGGKYIVAIDPL
DGSSNIDVNVSIGTIFSIYRRVSEQGADGTMEDCLQKGVRQVAAGYVIYGSSTMMVYTTG
HGVNGFTYDPSLGEFFLSHPNITSPETGSTYSINEGSFNSFPEGVKQYVNYCKESGYSAR
YIGSLVADFHRNLLKGGIYIYPATAKAPNGKLRLMYECNALAFIVEQAGGKATNGYQRIM
EMQPTELHQRCPLIIGSTEMVDKVEEYLKSEVEVG